Closed. This question needs details or clarity. It is not currently accepting answers.
Want to improve this question? Add details and clarify the problem by editing this post.
Closed 1 year ago.
Improve this question
I was trying to make a save dialog from a rich text document but I keep getting an error on the text.
Error:
ArgumentNullException
Argument 2: cannot convert from 'char[]' to 'string[]'
I'm new to c# so I'm not sure how to fix this.
System.IO.File.WriteAllLines(ofd.FileName.ToString(), richTextBox1.Text.ToArray());
Use a different method:
System.IO.File.WriteAllText(ofd.FileName, richTextBox1.Text);
I'd recommend avoiding to use Lines for this; it's a waste of resources to split the text into N strings only to write them all back to a combined file
Why didn't your first attempt work? WriteAllLines requires an array of strings. If you call .ToArray() on a string you get an array of characters; strings and characters are very different things.
ToArray() is a LINQ method that works because a string can be treated as an enumerable sequence of char. Typically it's very rare that you would do so and you would probably use the dedicated string.ToCharArray() method if you did want a char array from a string. Mostly I use it when splitting strings on multiple characters: someString.Split(".,?!'-/:;()".ToCharArray()); as it's more readable than putting each char separately
You're more likely to use ToArray() later on for things like filtering one array using LINQ and turning the result into an array again:
Person[] smiths = people.Where(person => person.LastName == "Smith").ToArray();
Other points:
OpenFileDialog's FileName is already a string; you don't need to ToString() it
Please get into the habit of renaming your controls after you add them to a form (top of the properties grid, the (Name) line, takes two seconds). It's a lot easier for us on the internet (and you in 3 weeks' time) to be able to read usernameTextBox and go "oh, that's the username textbox" than it is to be wondering "is it textbox56 or textbox27 that is the username? I'll just go into the form designer and check.."
Related
Closed. This question needs details or clarity. It is not currently accepting answers.
Want to improve this question? Add details and clarify the problem by editing this post.
Closed 2 years ago.
Improve this question
I want to convert a set of string into another meaningful string using c#
For Example
I want to convert the string "Aneesh" into "Syam"(The Name should Always convert into same Dummy name Always)
The Dummy values should be consistent based on an input seed
The Random Class of C# uses Seeds, if u would for example when you want to convert Aneesh you would put Aneesh as the input seed (just convert it into int with a method you like or set a reference int to it) and the Random Class if im not wrong should always do the same randoms then. Just convert those via int -> char -> string and you got your random word.
another way of doing it obviously would be setting up a consistent pair of strings, and just when converting taking the other one.
But i dont understand what you mean Aneesh into Syam, because u first said you want another meaningfull string which is consistent, and in the other hand you want string a swapped with string b, these are different things and can be acomplished in diff. ways
The simpliest solution that comes to my mind is to add 1 on every character:
var result = input.ToDictionary(x => x, x => new string(x.Select(y => y + 1).ToArray());
This produces different values for different keys, but is highly deterministic and unabmigious.
[
["Aneesh", "Boffti"],
["Head", "Ifbe"],
["Hand", "Iboe"]
]
Maybe you also need some check that character do not "overflow", that is z + 1 results in {, but instead of A.
If you need a bit more randomness you can of course add any different number than 1 and add that to every character.
Another appraoch which is not de-anonymizable as it produces compeleteley unrelated data is to just randomize based on the index within your input-list:
var result = input.Select((x, i) => $"Dummy{ i }");
Closed. This question needs details or clarity. It is not currently accepting answers.
Want to improve this question? Add details and clarify the problem by editing this post.
Closed 6 years ago.
Improve this question
Hello experts, I have to generate series of folders from a TextBox into specified location.I am having two textboxes to specify the limit of folders(say 30 folders).The problem am facing is that the folder names that i will be providing are alpha-numeric(say 121cs3h101) .
How to set limit when i provide an alpha-numeric values?
(For example: i provide textbox1=12cs3h101 and textbox2=12cs3h131 , i need the series limit to be generated). I am working with visual studio 2013 in c# windows form application. Thanks in advance.
ok I will try to give you a lead.
To parse a string or find specific characters one can use RegEx.Match or a simler method called String.Split. In both cases you have to be aware how your string is structured and how it can vary. The limits of variation are very important.
If as you say the beginning is always"12cs3h" you can either split the string at the character 'h'.
string[] sa = s.Split('h');
Or you can even use the index of 'h' (since the length seems to be fixed) and take the rest of the string to get the numbers.
int index = s.IndexOf('h');
The rest is up to you, ... convert, enumerate and so on.
EDIT: There is a nice method that does the enumeration job for you: Enumerable.Range Good luck
Closed. This question needs to be more focused. It is not currently accepting answers.
Want to improve this question? Update the question so it focuses on one problem only by editing this post.
Closed 8 years ago.
Improve this question
I have a list of terms (words), say around 500,000, they are loaded into some data structure, like a Dictionary or Trie perhaps.
In my program I want to open each text document and search for occurrences of these terms. When i find one I want to stop and transform the string in the text file (replacing it with the transformed string), and continue searching. Once complete with the file, I write to disk the new modified file.
My questions are as follows
What would be the best data structure to use for this purpose - a Tree type structure or .NET Dictionary
How do i search the text? Do I break it up into words and compare each chunk against the list I have, or some other method like RegEx, or .NET methods like Contains()?
I'm just looking for some advice on where to start, because I think speed will be really important when I'm dealing with very large and numerous text files.
EDIT: Yes the Transformation is same for each string - based on an algorithm - so each string will look different though. (like for example using a Cipher on the word to make is unreadable. Anyway I'm just looking for someone to point me in the right direction, I'm not familiar with many algorithms and data structures out there.
From a class I took once, I remember we covered a couple of different algorithms. Here are the ones that I remembered to be pretty effective with large text files...
Boyer-Moore:
http://en.wikipedia.org/wiki/Boyer%E2%80%93Moore_string_search_algorithm
Knuth-Morris-Pratt:
http://en.wikipedia.org/wiki/Knuth%E2%80%93Morris%E2%80%93Pratt_algorithm
These will only help with the lookup, then you can do the manipulation yourself
A hash table (Dictionary) is going to give you faster lookups than a tree structure. A well-built hash table can find a matching word entry with two or three probes, while a tree structure may require up to an order of magnitude more comparisons.
As for splitting up the words, it would seem to be simple enough to collect all alphabetical characters (and possibly digit characters) up to the next whitespace or punctuation character for each word. You will probably want to convert each word into all-lowercase before looking it up in the dictionary.
Closed. This question needs to be more focused. It is not currently accepting answers.
Want to improve this question? Update the question so it focuses on one problem only by editing this post.
Closed 9 years ago.
Improve this question
In one of the interview I was asked to test a method. The details are mentioned below. Though I could answer , still they were expecting some more test cases. Am I missing any scenarios here ?
string concatenatefunc(strin1,string2).
{
//returns concatenation
}
This method accepts two string parameters and returns the concatenation. No other details are mentioned. I need to test this method and i have written below scenarios/unit test cases:
1.Pass empty parameters and see empty string is returned
2.Pass valid non empty strings and see the string returned is correct or not.
3.Pass the special characters in the both the parameters and test the response.
4.Pass integers and test the response.
5.pass large strings(not sure what we can give as the max length) and test the response.
....
Anything to add here?
You're not testing for null parameters.
Test for multi language support. An area that many developers fail to test which can give a guy like me problems. I have the danish character 'ΓΈ' in my name. This has been a problem in my web based interactions with several VERY BIG companies including software companies, preventing me from logins, accounts, payments etc.
Number 5 will really depend on the size of available resources so testing that might be problematic.
You could add tests for either parameter being empty and see if the non-empty parameter is returned
Same for Passing integers, test if either parameter is integer
Then you could start mixing them empty/integer, non-empty/integer, etc. and reverse
Closed. This question is opinion-based. It is not currently accepting answers.
Want to improve this question? Update the question so it can be answered with facts and citations by editing this post.
Closed 7 years ago.
Improve this question
I have a FASTA file containing several protein sequences. The format is like
----------------------
>protein1
MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAAR
MASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTE
RMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAE
GKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSK
IPVHPNDHVNKSQ
>protein2
MRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRP
LPAWFDEAKFGVFIHWGVFSVPAWGSEWFWWHWQGEGRPYQRF
MRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLT
TKHHEGFTNW*
>protein3
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGF
CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKF
SNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTY`
-----------------------------------
Is there a good way to read in this file and store the sequences separately?
Thanks
To do this one way is to:
Create a vector where each location
holds a name and the sequence
Go through the file line by line
If the line starts with > then add
an element to the end of the vector
and save the line.substring(1) to
the element as the protein name.
Initialize the sequence in the
element to equal "".
If the line.length == 0 then it is
blank and do nothing
Else the line doesn't start with >
then it is part of the sequence so
go current vector element.sequence
+= line. Thus way each line between >protein2 and >protein3 is
concatenated and saved to the
sequence of protein2
I think maybe a little more detail about the exact file structure could be helpful. Just looking at what you have (and a quick peek at the samples on wikipedia) suggest that the name of the protein is prepended with a >, followed by at least one line break, so that would be a good place to start.
You could split the file on newline, and look for a > character to determine the name.
From there it is a little less clear because I'm not sure if the sequence data is all in one line (no linebreaks) or if it could have linebreaks. If there are none, then you should be able to just store that sequence information, and move on to the next protein name. Something like this:
var reader = new StreamReader("C:\myfile.fasta");
while(true)
{
var line = reader.ReadLine();
if(string.IsNullOrEmpty(line))
break;
if(line.StartsWith(">"))
StoreProteinName(line);
else
StoreSequence(line);
}
If it were me, I would probably use TDD and some sample data to build out a simple parser, and then keep plugging in samples until I felt I had covered all of major variances in the format.
Can you use a language other than C#? There are excellent libraries for dealing with FASTA files and other biological sequence in Perl, Python, Ruby, Java, and R (off the top of my head). They're usually branded Bio* (i.e. BioPerl, BioJava, etc)
If you're interested in C or C++, check out the answers to this question over at Biostar:
http://biostar.stackexchange.com/questions/1516/c-c-libraries-for-bioinformatics
Do yourself a favor, and don't reinvent the wheel if you don't have to.